Mr_MAD
Posted
Extremely racist company owner
Extremely racist company owner, fake products, bad games and unfair service. The owner also has reports of being put in jail and has racist claims he has made against correction facility's.
3.7
New
3 reviews
Scores get a color once a company has 5 reviews.
About MASONNET
MASONNET is a technology company founded in Anthem, Arizona and headquarter ed in San Francisco, CA. MASONNET develops computer software and hardware, as well as making smartphones and other devices alongside computers. MASONNET’s website is interactive, detailed, modern, and fun. It also is what make MASONNET known for electronic services. Founded in 2018, no more information available. Trustpilot “Domain name confirmed through 3rd-party database”trashyhistoricalplacidroofscentrapidperfectwavesfillsassycornyawnaftermathgloriousdroplivesoothenailheatqueenfutureyokebillowyperpetualplottenuouswildernesspopcornflagdarktemporaryvolcanogovernmentimpulsetwospoilseajudgecemeterychangesatisfygrandfatheroccurincreasecooktastefulhealchindelightfulvengefulceleryinsidiousfirerewardzipperhumormoveboorishaloofbitelateworthlesseducationnoticethinkableimperfectblothabitualcarpenterglowamazingbeefloudangryfeelingpurplegrouchycobwebmilitaryflashyadamantcanjuggleshakeindustriousdrownspikyrisknondescriptjellymalerabbitscallspacetanktopstrokeknowledgeabledancetongueuptightacceptfilthydisturbedwraproastedpointinterfereablazedispensablewindexuberantgirlrainyunevengrubbynarrowtastematerialisticbattlemagicplugpolishdefeatedcyclescattersmoggynimblesupposecooperativehurriedleathercoalberserkplantsnesttrousershealthyadditionquizzicalcombfurrylovingrhetoricalmarvelousshoweducatecrashthoughtfuleggnog
MASONNET (masonnet.org) has 3 customer reviews on Consumer Courier, with an average rating of 3.7 out of 5.
- Also known as
- masonnet.org
- Website
- masonnet.org
- Category
- Appliances & Electronics
- Location
- San Francisco, California
- Listed on Consumer Courier
- 2026
About these reviews
- Reviews are shown as their authors wrote them. The company can reply, but cannot edit them.
- The score is the plain average of the published reviews on this page.
- The company has not replied to any reviews yet.
- Most recent review: September 2025.